MCP server analyzing Windows ETW (.etl) traces — 54 tools spanning CPU/wait stacks, image-load gaps, file/disk/mmap I/O, VirtualAlloc, network, registry, ALPC, DPC/ISR, CLR (GC/JIT/alloc/exception/contention), NT heap, and any user-mode ETW provider. Domain-neutral.
View on GitHub →
Try with Claude — $10 free →
Quick Install
Copy the config for your editor. Some servers may need additional setup — check the README.
Add to claude_desktop_config.json:
{
"mcpServers": {
"wpa-mcp": {
"command": "npx",
"args": [
"-y",
"tooluse-labs/wpa-mcp"
]
}
}
}
Run in terminal:
claude mcp add wpa-mcp npx -y tooluse-labs/wpa-mcp
Add to .cursor/mcp.json:
{
"mcpServers": {
"wpa-mcp": {
"command": "npx",
"args": [
"-y",
"tooluse-labs/wpa-mcp"
]
}
}
}
Topics
claude-codecodexetwmcpmcp-serverperfviewtrace-analysiswindows-performancewpa